PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 228aa    MW: 25215.4 Da    PI: 7.2482
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014121genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.24.1e-0988134551
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  k+  r   NReA r++R++Kka+++ Le++v  L a N++L k+++ 
  Lus10014121  88 KKKQRPVGNREAVRKYREKKKARTASLEDEVVRLRALNQQLMKRVQG 134
                  44445556**********************************99874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-1379152No hitNo description
SMARTSM003383.2E-984151IPR004827Basic-leucine zipper domain
PfamPF077167.5E-1385139IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.16386133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.24E-788134No hitNo description
CDDcd146865.54E-1396143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDDGEVDFSH QGVFPEIPSS GSMDTFFDDL LKDTHACTHT HTCNPPGPDY SHTHTCFHVH  60
TKIVSAPSDD KLCRNDTAES VDKNSKKKKK QRPVGNREAV RKYREKKKAR TASLEDEVVR  120
LRALNQQLMK RVQGQAALEA EIARLKCLLV DIRGRIEGEI GSFLYQKPAP AANVNWSSSS  180
GLGGGAYVVH PCDMQSSDQV YTGCDFENLQ CMMNQHSGTK DFPVSCL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18592KKKKKQRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534148.21e-113PREDICTED: uncharacterized protein LOC8266428 isoform X1
RefseqXP_015583847.11e-113PREDICTED: uncharacterized protein LOC8266428 isoform X2
SwissprotQ8GTS29e-90BZP23_ARATH; Basic leucine zipper 23
TrEMBLB9T7C91e-112B9T7C9_RICCO; DNA binding protein, putative
STRINGVIT_03s0038g02420.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.18e-91bZIP family protein